PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G029000.1.p
Common NameLOC101784276, SETIT_022099mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 434aa    MW: 46810.8 Da    PI: 7.7386
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G029000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-32241295155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt++LHerFve+v+qLGG++kAtPk il+lm+ +gLt++h+kSHLQkYR+
  Seita.3G029000.1.p 241 KTRIRWTQDLHERFVECVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRI 295
                         68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.008238298IPR017930Myb domain
SuperFamilySSF466895.91E-18239295IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-30240296IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-24241296IPR006447Myb domain, plants
PfamPF002494.6E-9245294IPR001005SANT/Myb domain
PfamPF143791.8E-22328373IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MMNTKKIKLH DHHFGSPLYD PQMFPATAAA GLSFHPGLVG SLPQQHGGAG GWLQEEYSPT  60
PRTVLATQGS CVGSDPAAFF AAEHLLGMAR FDCTLGSTAL PAMTATKTAA PFVRSPEAEQ  120
LYRPLDPLLL RDGSVRTYYV RPQQRDATEA PPPLKLPLQQ QQERGHGLYG NGSTGRLLGG  180
GEPKAPSFSP HATANTLIQA MESPGMQSPI ENTLSRSCSI GAPASHTGNV VAAAGHGAPS  240
KTRIRWTQDL HERFVECVNQ LGGADKATPK GILKLMNSDG LTIYHIKSHL QKYRIAKYMP  300
ASTSSEGKQE KRAAGNDAQN LDPSTGSQIT EALRVQVDVQ RRLHEQLEIQ RNLQMRIEAQ  360
GKKLQKMFEE QLKASRTVME PREELQLQDA GGIGAAAFPG VSEQEGEDAF DDVQLLSVAS  420
SGYNDARFPS KIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960204.10.0PREDICTED: uncharacterized protein LOC101784276
RefseqXP_004960203.10.0PREDICTED: uncharacterized protein LOC101784276
RefseqXP_004960202.10.0PREDICTED: uncharacterized protein LOC101784276
TrEMBLK3Z6D00.0K3Z6D0_SETIT; Uncharacterized protein
STRINGSi022099m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69333751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-64G2-like family protein